Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q2FH56

Expression Region

1-276

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tim23 Rabbit Polyclonal Antibody
HA500398 100 µL

Tim23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDKN2AIPNL Rabbit Polyclonal Antibody
TA369943 100 µL

CDKN2AIPNL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCM2 Rabbit Monoclonal Antibody [Clone ID: R02-0D3]
TA421799 100 µL

MCM2 Rabbit Monoclonal Antibody [Clone ID: R02-0D3]

Sign In for Pricing
View Details
Recombinant Human TIGIT Protein (aa 22-141, His Tag)
PKSH033394-01 10 µg

Recombinant Human TIGIT Protein (aa 22-141, His Tag)

Sign In for Pricing
View Details
Recombinant Human TIGIT Protein (aa 22-141, His Tag)
PKSH033394-02 50 µg

Recombinant Human TIGIT Protein (aa 22-141, His Tag)

Sign In for Pricing
View Details
PI 3 Kinase Class 3 Recombinant Rabbit Monoclonal Antibody [SY0286]
ET1607-74 100 µL

PI 3 Kinase Class 3 Recombinant Rabbit Monoclonal Antibody [SY0286]

Sign In for Pricing
View Details