Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q2FYQ6

Expression Region

1-276

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chst14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16142114 3x 1.0 µg

Chst14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Sycp3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
45950116 3x 1.0 µg

Sycp3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (rPAX8/1492), 0.2mg/mL
BNUB3196-100 1x 100 µL

PAX8 (Renal Cell Marker) (rPAX8/1492), 0.2mg/mL

Sign In for Pricing
View Details
PCMV-BAD (human) -Neo
BZ63530 1 Vial

PCMV-BAD (human) -Neo

Sign In for Pricing
View Details
VPS33B (Vacuolar Protein Sorting 33 Homolog B (yeast), FLJ14848) (Biotin)
MBS6174618-01 0.1 mL

VPS33B (Vacuolar Protein Sorting 33 Homolog B (yeast), FLJ14848) (Biotin)

Sign In for Pricing
View Details
VPS33B (Vacuolar Protein Sorting 33 Homolog B (yeast), FLJ14848) (Biotin)
MBS6174618-02 5x 0.1 mL

VPS33B (Vacuolar Protein Sorting 33 Homolog B (yeast), FLJ14848) (Biotin)

Sign In for Pricing
View Details