Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q2FYQ6

Expression Region

1-276

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FDX2 (NM_001031734) Human Recombinant Protein
E45H37651M5 20 µg

FDX2 (NM_001031734) Human Recombinant Protein

Sign In for Pricing
View Details
Insulin Recombinant Rabbit mAb, AP conjugated
orb3163325 100 µL

Insulin Recombinant Rabbit mAb, AP conjugated

Sign In for Pricing
View Details
RING Finger Protein 182 (RNF182, E3 Ubiquitin-protein Ligase RNF182) (MaxLight 490)
MBS6203013-01 0.1 mL

RING Finger Protein 182 (RNF182, E3 Ubiquitin-protein Ligase RNF182) (MaxLight 490)

Sign In for Pricing
View Details
RING Finger Protein 182 (RNF182, E3 Ubiquitin-protein Ligase RNF182) (MaxLight 490)
MBS6203013-02 5x 0.1 mL

RING Finger Protein 182 (RNF182, E3 Ubiquitin-protein Ligase RNF182) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) CG12056 Polyclonal Antibody
MBS9014084 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) CG12056 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-STAT3 (S727) Antibody
A74922-100UL 100 µL

Phospho-STAT3 (S727) Antibody

Sign In for Pricing
View Details