Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q2FYQ6

Expression Region

1-276

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-3- (9-anthryl) -D-alanine
sc-285633 250 mg

Fmoc-3- (9-anthryl) -D-alanine

Sign In for Pricing
View Details
SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (PE)
MBS6350216-01 0.2 mL

SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (PE)

Sign In for Pricing
View Details
SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (PE)
MBS6350216-02 5x 0.2 mL

SP6, ID (SP6, KLF14, Transcription factor Sp6, Krueppel-like factor 14) (PE)

Sign In for Pricing
View Details
NAPSB siRNA Oligos set (Human)
31456171 3x 5 nmol

NAPSB siRNA Oligos set (Human)

Sign In for Pricing
View Details
Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire) (MaxLight 405) discontinued
E1007-ML405 100 µL

Ebola Virus (Ebolavirus, EHF, EV, EVD, EBOV, Ebola Hemorrhagic Fever, Ebola Virus Zaire) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Horse Protein Scribble Homolog (SCRIB) ELISA Kit
MBS9926683-01 48 Well

Horse Protein Scribble Homolog (SCRIB) ELISA Kit

Sign In for Pricing
View Details