Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q5HG39

Expression Region

1-276

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Fluoroquinoline-8-carboxylic Acid (~90%)
TRC-B438558-10MG 10 mg

6-Fluoroquinoline-8-carboxylic Acid (~90%)

Sign In for Pricing
View Details
Cox4i2 Mouse Gene Knockout Kit (CRISPR)
KN503721 1 Kit

Cox4i2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NPAS4 activation kit by CRISPRa
GA116949 1 Kit

Human NPAS4 activation kit by CRISPRa

Sign In for Pricing
View Details
HERPUD1 Human Gene Knockout Kit (CRISPR)
KN400693 1 Kit

HERPUD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR509-2 Human qPCR Primer Pair (MI0005530)
HP300663 200 Reactions

MIR509-2 Human qPCR Primer Pair (MI0005530)

Sign In for Pricing
View Details
Cyhalodiamide
TRC-C937260-250MG 250 mg

Cyhalodiamide

Sign In for Pricing
View Details