Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q6G9H9

Expression Region

1-276

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GlnD Antibody
orb816236 2 mg

GlnD Antibody

Sign In for Pricing
View Details
UGT8 Antibody
A54867-50UG 50 µg

UGT8 Antibody

Sign In for Pricing
View Details
ACAD-11 shRNA Plasmid (m)
sc-140791-SH 20 µg

ACAD-11 shRNA Plasmid (m)

Sign In for Pricing
View Details
DPEP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
18527066 1.0 µg DNA

DPEP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Protein spinster homolog 1 (SPNS1) ELISA Kit
orb1656909-01 48 Tests

Human Protein spinster homolog 1 (SPNS1) ELISA Kit

Sign In for Pricing
View Details
Human Protein spinster homolog 1 (SPNS1) ELISA Kit
orb1656909-02 96 Tests

Human Protein spinster homolog 1 (SPNS1) ELISA Kit

Sign In for Pricing
View Details