Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q6GH26

Expression Region

1-276

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFGAFIFVMIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPIRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYNESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF451 (NM_001031623) Human Over-expression Lysate
LY422216 100 µg

ZNF451 (NM_001031623) Human Over-expression Lysate

Sign In for Pricing
View Details
TAG72 Mouse Monoclonal Antibody [Clone ID: B72.3]
AM32243PU-T 20 µg

TAG72 Mouse Monoclonal Antibody [Clone ID: B72.3]

Sign In for Pricing
View Details
DEFB121 (NM_001011878) Human Over-expression Lysate
LC423307 20 µg

DEFB121 (NM_001011878) Human Over-expression Lysate

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF488A conjugate, 0.1mg/mL
BNC880775-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF405S conjugate, 0.1mg/mL
BNC041091-100 1x 100 µL

PS2 (TFF1/1091), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OTOA (N-term) Rabbit Polyclonal Antibody
AP53126PU-N 400 µL

OTOA (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details