Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q6GH26

Expression Region

1-276

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFGAFIFVMIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPIRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYNESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]
CF807575 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]

Sign In for Pricing
View Details
Calpain 5 (CAPN5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D2]
TA804810BM 100 µL

Calpain 5 (CAPN5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D2]

Sign In for Pricing
View Details
2-(2-Formylhydrazinylidene)-pentanedioic Acid
TRC-F735500-1G 1 g

2-(2-Formylhydrazinylidene)-pentanedioic Acid

Sign In for Pricing
View Details
Human STEAP3 activation kit by CRISPRa
GA110635 1 Kit

Human STEAP3 activation kit by CRISPRa

Sign In for Pricing
View Details
FATP2 (SLC27A2) Human Gene Knockout Kit (CRISPR)
KN421033 1 Kit

FATP2 (SLC27A2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tnfrsf12a Mouse Gene Knockout Kit (CRISPR)
KN317976RB 1 Kit

Tnfrsf12a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details