Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q99UA1

Expression Region

1-276

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Fibroblast Activation Protein alpha/FAP Antibody (FAP/4851) [Alexa Fluor 405]
NBP3-14219AF405 0.1 mL

Mouse Monoclonal Fibroblast Activation Protein alpha/FAP Antibody (FAP/4851) [Alexa Fluor 405]

Sign In for Pricing
View Details
Canine Prorelaxin,RLN ELISA KIT
ELI-04034d 96 Tests

Canine Prorelaxin,RLN ELISA KIT

Sign In for Pricing
View Details
Recombinant Human Membrane Metalloendopeptidase
MBS147120-01 0.002 mg

Recombinant Human Membrane Metalloendopeptidase

Sign In for Pricing
View Details
Recombinant Human Membrane Metalloendopeptidase
MBS147120-02 0.01 mg

Recombinant Human Membrane Metalloendopeptidase

Sign In for Pricing
View Details
Recombinant Human Membrane Metalloendopeptidase
MBS147120-03 1 mg

Recombinant Human Membrane Metalloendopeptidase

Sign In for Pricing
View Details
Recombinant Human Membrane Metalloendopeptidase
MBS147120-04 5x 1 mg

Recombinant Human Membrane Metalloendopeptidase

Sign In for Pricing
View Details