Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (VNG_0610G)

This Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (VNG_0610G) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

Q9HRP0

Expression Region

1-276

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METGRGLVELARPVNTLAAGALTFIGAFVAGGAVGRPAATGAAVGATWLATAGGNAINDY FDREVDRINDPDRAIPRGAVSPRGALAYSVVLFVGAAALAATLPVLAVCIAALNLAGLLT YTQYLKGRPGAGNALVAYLGGSTFVFGAAAVGSPLAGGVLAALAALSTFAREVIKDVEDL AGDRAAGLRTLPVVVGHQRALAVSAVFVVGAAAASPVPYLVGVFGWWYLVAVCPGVVVMV VAAARSYTDPAAGQRLLKRGQLLAAAAFVVGRLVTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Retn (NM_022984) AAV Particle
MR200462A1V 250 µL

Mouse Retn (NM_022984) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal Inorganic Pyrophosphatase/PPA1 Antibody (4G4) [mFluor Violet 500 SE]
NBP2-59471MFV500 0.1 mL

Mouse Monoclonal Inorganic Pyrophosphatase/PPA1 Antibody (4G4) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
AMOT (Angiomotin)
053278 200 µL

AMOT (Angiomotin)

Sign In for Pricing
View Details
CD83 Antibody, Biotin conjugated
A16666-50UG 50 µg

CD83 Antibody, Biotin conjugated

Sign In for Pricing
View Details
AMD1 Recombinant Protein Antigen
NBP1-87094PEP 0.1 mL

AMD1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bialaphos Sodium Salt
40210001-1 100 mg

Bialaphos Sodium Salt

Sign In for Pricing
View Details