Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (VNG_0610G)

This Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (VNG_0610G) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

Q9HRP0

Expression Region

1-276

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METGRGLVELARPVNTLAAGALTFIGAFVAGGAVGRPAATGAAVGATWLATAGGNAINDY FDREVDRINDPDRAIPRGAVSPRGALAYSVVLFVGAAALAATLPVLAVCIAALNLAGLLT YTQYLKGRPGAGNALVAYLGGSTFVFGAAAVGSPLAGGVLAALAALSTFAREVIKDVEDL AGDRAAGLRTLPVVVGHQRALAVSAVFVVGAAAASPVPYLVGVFGWWYLVAVCPGVVVMV VAAARSYTDPAAGQRLLKRGQLLAAAAFVVGRLVTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp25 3'UTR Lenti-reporter-Luc Vector
49303084 1.0 µg

Usp25 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SH3GLB1 (Endophilin-B1, Bax-interacting Factor 1, Bif-1, SH3 Domain-containing GRB2-like Protein B1, KIAA0491, CGI-61) (MaxLight 550)
MBS6394131-01 0.1 mL

SH3GLB1 (Endophilin-B1, Bax-interacting Factor 1, Bif-1, SH3 Domain-containing GRB2-like Protein B1, KIAA0491, CGI-61) (MaxLight 550)

Sign In for Pricing
View Details
SH3GLB1 (Endophilin-B1, Bax-interacting Factor 1, Bif-1, SH3 Domain-containing GRB2-like Protein B1, KIAA0491, CGI-61) (MaxLight 550)
MBS6394131-02 5x 0.1 mL

SH3GLB1 (Endophilin-B1, Bax-interacting Factor 1, Bif-1, SH3 Domain-containing GRB2-like Protein B1, KIAA0491, CGI-61) (MaxLight 550)

Sign In for Pricing
View Details
PCDH15 (NM_001142763) Human Over-expression Lysate
LS065217-100ug 100 µg

PCDH15 (NM_001142763) Human Over-expression Lysate

Sign In for Pricing
View Details
Katnbl1 (NM_024254) Mouse Tagged Lenti ORF Clone
MR204162L3 10 µg

Katnbl1 (NM_024254) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Horse Tripartite Motif-Containing Protein 14 (TRIM14) ELISA Kit
MBS9904768-01 48 Well

Horse Tripartite Motif-Containing Protein 14 (TRIM14) ELISA Kit

Sign In for Pricing
View Details