Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Myelin proteolipid protein (PLP1)

This Recombinant Chicken Myelin proteolipid protein (PLP1) spans the amino acid sequence from region 2-277.

Product Specifications

Product Name Alternative

Myelin proteolipid protein, PLP, Lipophilin

UniProt

P23289

Expression Region

2-277

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLLECCARCLIGAPFASLVATGLCFFGVALFCGCGHEALTGTEQLIETYFSKNYQDYEYL IDVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYRTTICGKGLSATVTGGP KGRGARGPQRAHSLQRVCQCLGKWLGHPDKFVGITYVLTIVWLLAFACSAVPVYIYFNTW TTCQSIAFPTKTTASIGTLCADARMYGVLPWNAFPGKVCGSNLLSICKTSEFQMTFHLFI AAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2961), CF568 conjugate, 0.1mg/mL
BNC682961-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2961), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF488A conjugate, 0.1mg/mL
BNC881976-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF405S conjugate, 0.1mg/mL
BNC042624-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details