Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Myelin proteolipid protein (PLP1)

This Recombinant Rabbit Myelin proteolipid protein (PLP1) spans the amino acid sequence from region 2-277.

Product Specifications

Product Name Alternative

Myelin proteolipid protein, PLP, Lipophilin

UniProt

P47789

Expression Region

2-277

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYL INVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ KGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTW TTCQSIAFPSKTSASIGTLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFI AAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Septin-3 Antibody
NBP1-90339-25ul 25 µL

Rabbit Polyclonal Septin-3 Antibody

Sign In for Pricing
View Details
C1orf146 Polyclonal Antibody, HRP Conjugated
bs-15024R-HRP 100 µL

C1orf146 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Transthyretin (TTR) Antibody
abx274879-01 50 Tests

Transthyretin (TTR) Antibody

Sign In for Pricing
View Details
Transthyretin (TTR) Antibody
abx274879-02 100 Tests

Transthyretin (TTR) Antibody

Sign In for Pricing
View Details
Transthyretin (TTR) Antibody
abx274879-03 200 Tests

Transthyretin (TTR) Antibody

Sign In for Pricing
View Details
Transthyretin (TTR) Antibody
abx274879-04 500 Tests

Transthyretin (TTR) Antibody

Sign In for Pricing
View Details