Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Myelin proteolipid protein (PLP1)

This Recombinant Rabbit Myelin proteolipid protein (PLP1) spans the amino acid sequence from region 2-277.

Product Specifications

Product Name Alternative

Myelin proteolipid protein, PLP, Lipophilin

UniProt

P47789

Expression Region

2-277

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYL INVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ KGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTW TTCQSIAFPSKTSASIGTLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFI AAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2-2 Recombinant Antibody AE00256
AE00256 0.1mg

NKX2-2 Recombinant Antibody AE00256

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni hisC Protein (aa 1-364)
VAng-Lsx6263-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni hisC Protein (aa 1-364)

Sign In for Pricing
View Details
Goat TBCC domain containing protein 1 (TBCCD1) ELISA Kit
GTR10325791 96 Well

Goat TBCC domain containing protein 1 (TBCCD1) ELISA Kit

Sign In for Pricing
View Details
PRPSAP1 Human qPCR Primer Pair (NM_002766)
HP206398 200 Reactions

PRPSAP1 Human qPCR Primer Pair (NM_002766)

Sign In for Pricing
View Details
Direct blue 71
sc-218247 50 g

Direct blue 71

Sign In for Pricing
View Details
HAS1 Adenovirus (Rat)
23013056 1.0 mL

HAS1 Adenovirus (Rat)

Sign In for Pricing
View Details