Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Janthinobacterium sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A6T273

Expression Region

1-277

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPILALKAIIMGIVEGFTEFLPISSTGHLILAGSLLDFTGPKVKVFEIAIQTGAMLAVV WEYRAKIAAVLGGLLTERKAQKFALNIIIAFLPAALLGLVFASKIKEKLFAPVPVAIAFI VGGFIILWIEKRNRNTDFVARVETVDDMTMLDALKVGCAQAFALIPGTSRSGASIIGGMF FGLSRKAATEFSFFLAIPTLMGATVYSVYKDRALLSMADIPLFGLGGFAAFVSAFLCVRW LLRYISTHDFTFFAYYRIVFGLFVLLSAYYGWVVWAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2310022A10Rik ORF Vector (Mouse) (pORF)
ORF037001 1.0 µg DNA

2310022A10Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SPAPB15E9.06 Antibody
orb856932 2 mg

SPAPB15E9.06 Antibody

Sign In for Pricing
View Details
SH2D1B Rabbit Polyclonal Antibody (Biotin)
orb454184 100 µL

SH2D1B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DENTT antibody
70R-DR007 100 ug

DENTT antibody

Sign In for Pricing
View Details
Phospho-ERK5 (Thr218 + Tyr220) Rabbit Polyclonal Antibody (BF350)
orb2543213 100 µL

Phospho-ERK5 (Thr218 + Tyr220) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
FOXE3, ID (FOXE3, FKHL12, FREAC8, Forkhead box protein E3, Forkhead-related protein FKHL12, Forkhead-related transcription factor 8) (Azide free) (HRP)
MBS6299766-01 0.2 mL

FOXE3, ID (FOXE3, FKHL12, FREAC8, Forkhead box protein E3, Forkhead-related protein FKHL12, Forkhead-related transcription factor 8) (Azide free) (HRP)

Sign In for Pricing
View Details