Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0154 (AF_0154)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0154 (AF_0154) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0154

UniProt

O30083

Expression Region

1-277

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKMMGQMVITLREGFEAALLVAVLVAYLKRSGRTEEVRFAYYGTIAAIAAGFAIATAVI VAYGGLHGEQKELFEGFASYLAVGVLTYMILWMAGKDVRGEVERRAEAKFKWGIALIAFV FVVREVIETVLFLTPFAIAEFTTTVIGASAGAAVAITLAVLILRFEYRMSLRRFFYATSV LLAFIAAGLLGYGTHEFVEVLEEEGFEHPLFEKAYSLGIDESNPLHHKGLIGGILAVMFG YSASMEWVRLILQLGYLAAMLGLIHRSYGRVTERAEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CHEK1 (Ser317) Rabbit Polyclonal Antibody (BF594)
orb2412577 100 µL

Phospho-CHEK1 (Ser317) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
RAX (Retinal Homeobox Protein Rx)
490150 100 µL

RAX (Retinal Homeobox Protein Rx)

Sign In for Pricing
View Details
TNF RSF13B Antibody
MBS9405792-01 0.1 mL

TNF RSF13B Antibody

Sign In for Pricing
View Details
TNF RSF13B Antibody
MBS9405792-02 5x 0.1 mL

TNF RSF13B Antibody

Sign In for Pricing
View Details
N-Acetylprocainamide Antibody
B2012961 100 µg

N-Acetylprocainamide Antibody

Sign In for Pricing
View Details
Recombinant Histone H1 Antibody
V3735IHC-7ML 7 mL

Recombinant Histone H1 Antibody

Sign In for Pricing
View Details