Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0154 (AF_0154)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0154 (AF_0154) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0154

UniProt

O30083

Expression Region

1-277

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKMMGQMVITLREGFEAALLVAVLVAYLKRSGRTEEVRFAYYGTIAAIAAGFAIATAVI VAYGGLHGEQKELFEGFASYLAVGVLTYMILWMAGKDVRGEVERRAEAKFKWGIALIAFV FVVREVIETVLFLTPFAIAEFTTTVIGASAGAAVAITLAVLILRFEYRMSLRRFFYATSV LLAFIAAGLLGYGTHEFVEVLEEEGFEHPLFEKAYSLGIDESNPLHHKGLIGGILAVMFG YSASMEWVRLILQLGYLAAMLGLIHRSYGRVTERAEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERVPABLB-1 ORF Vector (Human) (pORF)
ORF019030 1.0 µg DNA

ERVPABLB-1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
P/P023/NL303/TWM-297X105-1 Prohibited Activity Signs & Labels (Adhesive)
234435 1 Pack (1 Panel (s) x 1 Pack)

P/P023/NL303/TWM-297X105-1 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details
PIC P022-Dia 025-PE-ROLL/1 Facility & Office Signs & Labels (Adhesive)
824673 250 Roll (250 Panel (s) x 1 Roll)

PIC P022-Dia 025-PE-ROLL/1 Facility & Office Signs & Labels (Adhesive)

Sign In for Pricing
View Details
GFM2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV710371 1.0 µg DNA

GFM2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Hsa-miR-718 miRNA Agomir
orb1920672-01 5 nmol

Hsa-miR-718 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-718 miRNA Agomir
orb1920672-02 10 nmol

Hsa-miR-718 miRNA Agomir

Sign In for Pricing
View Details