Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Protein A38 (A38L, A41L)

This Recombinant Variola virus Protein A38 (A38L, A41L) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Protein A38

UniProt

P33853

Expression Region

1-277

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRVRILLIYLCTFVVITSTKTIEYTACNDTIIIPCTIDNPTKYIRWKLDNHNILTYNKT SKTIILSKWHTSAKLHSLSDNDVSLIIKYKDILPGTYTCEDNTGIKSTVKLVQRHTNWFN DHHTMLMFIFTGITLFLLFLEIAYTSISVVFSTNLGILQVFGCIIAMIELCGAFLFYPSM FTLRHIIGLLMMTLPSIFLIITKVFSFWLLCKLSCAVHLIIYYQLAGYILTVLGLGLSLK ECVDGTLLLSGLGTIMVSEHFSLLFLVCFPSTQRDYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WST-1
TRC-W500000-25MG 25 mg

WST-1

Sign In for Pricing
View Details
CACNG6 (NM_145814) Human Recombinant Protein
TP305809M 100 µg

CACNG6 (NM_145814) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS808701 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit
E-BC-K097-M 96 T (80 samples)

Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit

Sign In for Pricing
View Details
PCB Recombinant Rabbit Monoclonal Antibody [JE40-24]
HA721546 100 µL

PCB Recombinant Rabbit Monoclonal Antibody [JE40-24]

Sign In for Pricing
View Details
TRAF5 (NM_001033910) Human Over-expression Lysate
LY422427 100 µg

TRAF5 (NM_001033910) Human Over-expression Lysate

Sign In for Pricing
View Details