Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P51232

Expression Region

1-278

Origin

Porphyra purpurea

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYWNLKRTNQSTFEKVGPIPRSITNTFEKFRKELDPNGESEAIEEFRLSRHQTITSVKY IFLLLISPVLVNQASKFFDFGPCIDYLWNQEQPKIFINSSQEERAFAELQRFEEKIHFEV LLNPSGNISYEIIEKRVQLKARELGEYYANESANAVKNILSDILSIAVFILLMITGQRQI SIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHLGLPESRDFIF LFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, P
MBS6131532-01 0.1 mL

GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, P

Sign In for Pricing
View Details
GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, P
MBS6131532-02 5x 0.1 mL

GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspartate Aminotransferase, Mitochondrial, FABP-1, FABPpm, Fatty Acid-binding Protein, FLJ40994, Glutamate Oxaloacetate Transaminase 2, KAT4, KATIV, mAspAT, mitAAT, P

Sign In for Pricing
View Details
Ethyl 2- (2-ethoxy-2-oxoethyl) benzoate
PAA96134 1 g

Ethyl 2- (2-ethoxy-2-oxoethyl) benzoate

Sign In for Pricing
View Details
Human TMEM41B siRNA
abx905679-01 15 nmol

Human TMEM41B siRNA

Sign In for Pricing
View Details
Human TMEM41B siRNA
abx905679-02 30 nmol

Human TMEM41B siRNA

Sign In for Pricing
View Details
Thifluzamide
GW8386-1g 1 g

Thifluzamide

Sign In for Pricing
View Details