Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P51232

Expression Region

1-278

Origin

Porphyra purpurea

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYWNLKRTNQSTFEKVGPIPRSITNTFEKFRKELDPNGESEAIEEFRLSRHQTITSVKY IFLLLISPVLVNQASKFFDFGPCIDYLWNQEQPKIFINSSQEERAFAELQRFEEKIHFEV LLNPSGNISYEIIEKRVQLKARELGEYYANESANAVKNILSDILSIAVFILLMITGQRQI SIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHLGLPESRDFIF LFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDNRA Protein Lysate
OCOA00651-20UG 20 µg

EDNRA Protein Lysate

Sign In for Pricing
View Details
MGC70863 (NM_203302) Human Untagged Clone
SC125819 10 µg

MGC70863 (NM_203302) Human Untagged Clone

Sign In for Pricing
View Details
CMPK2 3'UTR GFP Stable Cell Line
TU054651 1.0 mL

CMPK2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ELISA kit for Rat N-acetylaspartate synthetase (NAT8L)
KTE100516-01 48 Tests

ELISA kit for Rat N-acetylaspartate synthetase (NAT8L)

Sign In for Pricing
View Details
ELISA kit for Rat N-acetylaspartate synthetase (NAT8L)
KTE100516-02 96 Tests

ELISA kit for Rat N-acetylaspartate synthetase (NAT8L)

Sign In for Pricing
View Details
ELISA kit for Rat N-acetylaspartate synthetase (NAT8L)
KTE100516-03 5x 96 Well

ELISA kit for Rat N-acetylaspartate synthetase (NAT8L)

Sign In for Pricing
View Details