Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P51232

Expression Region

1-278

Origin

Porphyra purpurea

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYWNLKRTNQSTFEKVGPIPRSITNTFEKFRKELDPNGESEAIEEFRLSRHQTITSVKY IFLLLISPVLVNQASKFFDFGPCIDYLWNQEQPKIFINSSQEERAFAELQRFEEKIHFEV LLNPSGNISYEIIEKRVQLKARELGEYYANESANAVKNILSDILSIAVFILLMITGQRQI SIVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHLGLPESRDFIF LFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Os05g0279400 Polyclonal Antibody
E917860 100 µL

Os05g0279400 Polyclonal Antibody

Sign In for Pricing
View Details
HDGF Polyclonal Antibody
bs-10956R 100 µL

HDGF Polyclonal Antibody

Sign In for Pricing
View Details
BBS9 (NM_198428) Human Over-expression Lysate
LS027241-20ug 20 µg

BBS9 (NM_198428) Human Over-expression Lysate

Sign In for Pricing
View Details
PPID Antibody - N-terminal region : Biotin (ARP56624_P050-Biotin)
ARP56624_P050-Biotin 100 µL

PPID Antibody - N-terminal region : Biotin (ARP56624_P050-Biotin)

Sign In for Pricing
View Details
MatP Antibody
orb817828 2 mg

MatP Antibody

Sign In for Pricing
View Details
DUB1A shRNA (m) Lentiviral Particles
sc-143186-V 200 µL

DUB1A shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details