Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Rhomboid protease glpG (glpG)

This Recombinant Yersinia pseudotuberculosis serotype IB Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

B2K5W4

Expression Region

1-278

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQLSAVQHELEQFLLDP LNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMLITGDMAV MSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLGGQMEKRLGTSKLLVLTI VSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLIA GYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATE3 Human Gene Knockout Kit (CRISPR)
KN425016 1 Kit

PATE3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fluo-4, Pentapotassium Salt
#50019 1x 500 µg

Fluo-4, Pentapotassium Salt

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR561956 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
Human LOC101059915 activation kit by CRISPRa
GA119437 1 Kit

Human LOC101059915 activation kit by CRISPRa

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/3141R), CF594 conjugate, 0.1mg/mL
BNC943141-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/3141R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A3 Human Gene Knockout Kit (CRISPR)
KN202117 1 Kit

S100A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details