Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q1XDQ5

Expression Region

1-278

Origin

Porphyra yezoensis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYWNLKRNNQFAFEKVGPIPRSITNTFEKFRKELDPNGESEAIEEFRISRHQTITSVKY ILLLFISPVLVNQASKFFVFGPCIDYLWNQEQPKIFLNSSQEERAFAELQRFEEKIHFEV LLNPSEDISYEIIEKRVQLKARELGEYYANESANAVKNILSDLVSILVFILLMITGQRQI AVVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHLGLPESRDFIF LFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF405S conjugate, 0.1mg/mL
BNC042304-500 1x 500 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TentaGel® MB CHO
MB160006.5G 5 g

TentaGel® MB CHO

Sign In for Pricing
View Details
Tissue FFPE Sections, Neural tissue
CS803824 5x 5 µm

Tissue FFPE Sections, Neural tissue

Sign In for Pricing
View Details
PCTAIRE2 (CDK17) (NM_002595) Human Over-expression Lysate
LY400928 100 µg

PCTAIRE2 (CDK17) (NM_002595) Human Over-expression Lysate

Sign In for Pricing
View Details
Col11a2 Mouse Gene Knockout Kit (CRISPR)
KN503615 1 Kit

Col11a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Desmoglein-1 (DSG1) (32-2B), CF647 conjugate, 0.1mg/mL
BNC473068-500 1x 500 µL

Desmoglein-1 (DSG1) (32-2B), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details