Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q1XDQ5

Expression Region

1-278

Origin

Porphyra yezoensis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYWNLKRNNQFAFEKVGPIPRSITNTFEKFRKELDPNGESEAIEEFRISRHQTITSVKY ILLLFISPVLVNQASKFFVFGPCIDYLWNQEQPKIFLNSSQEERAFAELQRFEEKIHFEV LLNPSEDISYEIIEKRVQLKARELGEYYANESANAVKNILSDLVSILVFILLMITGQRQI AVVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHLGLPESRDFIF LFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Obeticholic Acid Acyl-Beta-D-glucuronide
TRC-O099110-2.5MG 2.5 mg

Obeticholic Acid Acyl-Beta-D-glucuronide

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802906 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
STEAP1 (NM_012449) Human Recombinant Protein
TP303970M 100 µg

STEAP1 (NM_012449) Human Recombinant Protein

Sign In for Pricing
View Details
53BP1 (TP53BP1) Rabbit Monoclonal Antibody
TA423061 100 µL

53BP1 (TP53BP1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rhodanine
TRC-R318615-10G 10 g

Rhodanine

Sign In for Pricing
View Details
IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), Biotin conjugate, 0.1mg/mL
BNCB2001-500 1x 500 µL

IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details