Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q1XDQ5

Expression Region

1-278

Origin

Porphyra yezoensis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYWNLKRNNQFAFEKVGPIPRSITNTFEKFRKELDPNGESEAIEEFRISRHQTITSVKY ILLLFISPVLVNQASKFFVFGPCIDYLWNQEQPKIFLNSSQEERAFAELQRFEEKIHFEV LLNPSEDISYEIIEKRVQLKARELGEYYANESANAVKNILSDLVSILVFILLMITGQRQI AVVKSFLNEIIYGLSDTAKAFLIILFTDMFVGFHSPHGWEVIIEVILRHLGLPESRDFIF LFISTFPVILDTIFKYWIFRYLNQVSPSAVATYHNMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD39 (ENTPD1) (NM_001164181) Human Over-expression Lysate
LC431349 20 µg

CD39 (ENTPD1) (NM_001164181) Human Over-expression Lysate

Sign In for Pricing
View Details
Serum Response Factor (SRF) Rabbit Polyclonal Antibody
TA381996 100 µL

Serum Response Factor (SRF) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLBP Human Gene Knockout Kit (CRISPR)
KN402361 1 Kit

SLBP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha-Citral
TRC-C141275-250MG 250 mg

Alpha-Citral

Sign In for Pricing
View Details
Clathrin light chain (CLTB) Rabbit Polyclonal Antibody
AP50978PU-N 400 µL

Clathrin light chain (CLTB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM49B Human Gene Knockout Kit (CRISPR)
KN432769 1 Kit

TRIM49B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details