Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal membrane glycoprotein M6-a (Gpm6a)

This Recombinant Mouse Neuronal membrane glycoprotein M6-a (Gpm6a) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Neuronal membrane glycoprotein M6-a, M6a

UniProt

P35802

Expression Region

1-278

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp169 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4044404 1.0 µg DNA

Zfp169 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
S6 Ribosomal Protein discontinued
404352-01 50 µL

S6 Ribosomal Protein discontinued

Sign In for Pricing
View Details
S6 Ribosomal Protein discontinued
404352-02 100 µL

S6 Ribosomal Protein discontinued

Sign In for Pricing
View Details
GALK1 (A-2) Alexa Fluor® 546
sc-393404 AF546 200 µg/mL

GALK1 (A-2) Alexa Fluor® 546

Sign In for Pricing
View Details
ELISA Kit FOR Proton-activated chloride channel
E16513m 96 Tests

ELISA Kit FOR Proton-activated chloride channel

Sign In for Pricing
View Details
Cavy Prominin 2 (PROM2) ELISA Kit
MBS9921711 Inquire

Cavy Prominin 2 (PROM2) ELISA Kit

Sign In for Pricing
View Details