Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuronal membrane glycoprotein M6-a (Gpm6a)

This Recombinant Mouse Neuronal membrane glycoprotein M6-a (Gpm6a) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Neuronal membrane glycoprotein M6-a, M6a

UniProt

P35802

Expression Region

1-278

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORA26 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44588151 3x 1.0 µg DNA

SNORA26 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Insulin Receptor Alpha Antibody, Cy5.5 Conjugated
bs-0260R-Cy5.5 100 µL

Insulin Receptor Alpha Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 (CYP2E1)
SIPA929Hu01-01 10 µg

Recombinant Cytochrome P450 2E1 (CYP2E1)

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 (CYP2E1)
SIPA929Hu01-02 50 µg

Recombinant Cytochrome P450 2E1 (CYP2E1)

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 (CYP2E1)
SIPA929Hu01-03 200 µg

Recombinant Cytochrome P450 2E1 (CYP2E1)

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 (CYP2E1)
SIPA929Hu01-04 1 mg

Recombinant Cytochrome P450 2E1 (CYP2E1)

Sign In for Pricing
View Details