Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal membrane glycoprotein M6-a (GPM6A)

This Recombinant Human Neuronal membrane glycoprotein M6-a (GPM6A) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Neuronal membrane glycoprotein M6-a, M6a

UniProt

P51674

Expression Region

1-278

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details