Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Cholesterol 25-hydroxylase-like protein 2 (ch25hl2)

This Recombinant Danio rerio Cholesterol 25-hydroxylase-like protein 2 (ch25hl2) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Cholesterol 25-hydroxylase-like protein 2, EC= 1.14.99.-

UniProt

A8WGT1

Expression Region

1-279

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDISNTTWDLSNQSVLQPLWDYLQQNHESSLRSPLFPVILSVSMYLVLVFFYTVLDLLA PTWPSIRRYQIHQDRTVTWSNIGSTLALTTYNHLLYIFPAAVAQWLWRPPIPLPREAPTL TAFLLGIVGCTVVFDFQYYLWHLLHHRVGWLYRTFHALHHQYRQTFSLVTQYLSAWELFS VGFWTTVDPLLLQCHCLTAWAFMLFNIWVSTEDHCGYDFPWAMHRLVPFGLWGGALRHDA HHQLPGTNFAPFFAHWDWLGGTATMPAPVKTKKRDDKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF647 conjugate, 0.1mg/mL
BNC471203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details