Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Nitrate transport permease protein nrtB (nrtB)

This Recombinant Synechococcus elongatus Nitrate transport permease protein nrtB (nrtB) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Nitrate transport permease protein nrtB

UniProt

P38044

Expression Region

1-279

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVTLRPPSSVRRSAWVKNPKLKPFLPYVVCLPIFLAIWQVISAILGQDRLPGPINVVAN TWMPYIVEPFFDNGGTSKGLGLQILISLQRVAIGYLLAACTGILVGGVLGMSKFLGKGLD PVIQVLRTVPPLAWFPISLMVFQDANTSAIFVIFITAIWPIIINTAVGINQIPDDYNNVA RVLKLSKKDYILNILIPSTVPYVFAGLRIAVGLAWLAIVAAEMLKADGGIGYFIWDAYNA GGDGSSSQIILAIFYVGLVGLSLDRLVAWVGRLVSPVSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL
BNC472478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), CF488A conjugate, 0.1mg/mL
BNC880303-100 1x 100 µL

Neurofilament (NF-L) (NR-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details