Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0750 membrane protein yitT (yitT)

This Recombinant Bacillus subtilis UPF0750 membrane protein yitT (yitT) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

UPF0750 membrane protein yitT

UniProt

P39803

Expression Region

1-280

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLDQTKKLLIVIIGALLNAAGLNLFLIPADVYASGFTGVAQLLSSVVDQYAPFYISTGT LLFLLNIPVGILGWLKVGKSFTVYSILSVALTTLFMGILPETSLSHDILLNAVFGGVISA VGIGLTLKYGASTGGLDIVAMVLAKWKDKPVGTYFFILNGIIILTAGLLQGWEKALYTLV TLYVTTRVIDAIHTRHMKLTAMIVTKKADEIKEAIYGKMVRGITTVPAKGAFTNEQKEMM IIVITRYELYDLEKIVKEVDPKAFTNIVQTTGIFGFFRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-100 1x 100 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL
BNC882156-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF594 conjugate, 0.1mg/mL
BNC940393-500 1x 500 µL

Cytokeratin, multi (C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF647 conjugate, 0.1mg/mL
BNC470784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details