Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte antigen CD37 (Cd37)

This Recombinant Mouse Leukocyte antigen CD37 (Cd37) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Leukocyte antigen CD37, CD_antigen= CD37

UniProt

Q61470

Expression Region

1-281

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKV LAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQ ELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCS CYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHN NIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Alpha 1B adrenergic receptor (ADRA1B) ELISA Kit
GTR10320725 96 Well

Guinea Pig Alpha 1B adrenergic receptor (ADRA1B) ELISA Kit

Sign In for Pricing
View Details
Aspn (NM_001014008) Rat Tagged ORF Clone
RR212463 10 µg

Aspn (NM_001014008) Rat Tagged ORF Clone

Sign In for Pricing
View Details
AIS1-set siRNA/shRNA/RNAi Lentivector (Human)
11614091 4x 500 ng

AIS1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Tyr-Amyloid P Component (27-38) amide
orb372889-01 1 mg

Tyr-Amyloid P Component (27-38) amide

Sign In for Pricing
View Details
Tyr-Amyloid P Component (27-38) amide
orb372889-02 5 mg

Tyr-Amyloid P Component (27-38) amide

Sign In for Pricing
View Details
Tyr-Amyloid P Component (27-38) amide
orb372889-03 10 mg

Tyr-Amyloid P Component (27-38) amide

Sign In for Pricing
View Details