Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte antigen CD37 (Cd37)

This Recombinant Mouse Leukocyte antigen CD37 (Cd37) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Leukocyte antigen CD37, CD_antigen= CD37

UniProt

Q61470

Expression Region

1-281

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKV LAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQ ELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCS CYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHN NIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CA2 (Carbonic Anhydrase 2) CLIA Kit
MBS2531549-01 96 Tests

Mouse CA2 (Carbonic Anhydrase 2) CLIA Kit

Sign In for Pricing
View Details
Mouse CA2 (Carbonic Anhydrase 2) CLIA Kit
MBS2531549-02 5x 96 Tests

Mouse CA2 (Carbonic Anhydrase 2) CLIA Kit

Sign In for Pricing
View Details
TMEM43, ID (TMEM43, Transmembrane protein 43, Protein LUMA) (PE) discontinued
043003-PE 200 µL

TMEM43, ID (TMEM43, Transmembrane protein 43, Protein LUMA) (PE) discontinued

Sign In for Pricing
View Details
Dbr1 Rat siRNA Oligo Duplex (Locus ID 681234)
SR504821 1 Kit

Dbr1 Rat siRNA Oligo Duplex (Locus ID 681234)

Sign In for Pricing
View Details
Anti-SCARB2/CD36L2 Antibody (R2F16)
RHG70402 100 μg

Anti-SCARB2/CD36L2 Antibody (R2F16)

Sign In for Pricing
View Details
Recombinant Ocimum basilicum Germacrene-D synthase (GDS), partial
MBS1299910 Inquire

Recombinant Ocimum basilicum Germacrene-D synthase (GDS), partial

Sign In for Pricing
View Details