Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 5 (SCAMP5)

This Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 5 (SCAMP5) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Secretory carrier-associated membrane protein 5, Secretory carrier membrane protein 5

UniProt

Q6Z8F5

Expression Region

1-281

Origin

Oryza sativa subsp. japonica (Rice)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHHDPNPFDEGADDNPFSNGGGGGARRGGGGGGGGGGGGGKSQFSFGFGGLGGGSKGGAT VDIPLDNMSDSKGKGKELLQWEADLKRREADIRRREEALKSAGVPMEEKNWPPFFPIIHH DIANEIPANAQKLQYLAFASWLGIVLCLFWNFIAVIVCWIRGGDSKLFFLATIYGMLGMP LSYLMWYRPLYRAMRTDSAFSFGWFFLCYMLHIAFCVFAAIAPPVIFRGKSLTGILAAID TFSDHAIVGIFYFVGFALFCLETLVSIWVLQKVYMYFRGHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF594 conjugate, 0.1mg/mL
BNC942035-100 1x 100 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details