Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clc-like protein 5 (clc-5)

This Recombinant Clc-like protein 5 (clc-5) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Clc-like protein 5

UniProt

Q9NGJ7

Expression Region

1-281

Origin

Caenorhabditis elegans

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVFQTKLQKYQLATLISSVISNFLIFFATITPAWQVADDLDADRYVQSGLWLYCPGQAQ CWYIFSDSLINYYEKVDVCRFFLIGDCRKKLLRTPYFFGWHYAVLILNVISMICMSLCAA AVIFSYVKPARSRISVIMLDVFAGFASLLLCVSLIVFMVNAEMLESKYLIGIKNTYEKEY GYSYYLAGLAFVISVITVLFAALVSTYTFLFPEEVADSEYTLKMSNNQFAVRYNNDLPQP YQPPMSQLSMQIPSTEHGSYIAGAISPRGDFKSQTRHFYSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 4 (KRT4) (KRT4/2804), CF647 conjugate, 0.1mg/mL
BNC472804-100 1x 100 µL

Cytokeratin 4 (KRT4) (KRT4/2804), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Recombinant Protein
TP325494 20 µg

Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF640R conjugate, 0.1mg/mL
BNC401190-500 1x 500 µL

Cytokeratin 18 (KRT18/1190), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM67 Human Gene Knockout Kit (CRISPR)
KN417649 1 Kit

TRIM67 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat REG3A/HIP Protein (Fc Tag)
PKSR030285 100 µg

Recombinant Rat REG3A/HIP Protein (Fc Tag)

Sign In for Pricing
View Details
COQ10B (NM_025147) Human Recombinant Protein
TP305174M 100 µg

COQ10B (NM_025147) Human Recombinant Protein

Sign In for Pricing
View Details