Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clc-like protein 5 (clc-5)

This Recombinant Clc-like protein 5 (clc-5) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Clc-like protein 5

UniProt

Q9NGJ7

Expression Region

1-281

Origin

Caenorhabditis elegans

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVFQTKLQKYQLATLISSVISNFLIFFATITPAWQVADDLDADRYVQSGLWLYCPGQAQ CWYIFSDSLINYYEKVDVCRFFLIGDCRKKLLRTPYFFGWHYAVLILNVISMICMSLCAA AVIFSYVKPARSRISVIMLDVFAGFASLLLCVSLIVFMVNAEMLESKYLIGIKNTYEKEY GYSYYLAGLAFVISVITVLFAALVSTYTFLFPEEVADSEYTLKMSNNQFAVRYNNDLPQP YQPPMSQLSMQIPSTEHGSYIAGAISPRGDFKSQTRHFYSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD99/MIC2 Protein (Fc Tag)
PKSR030229 100 µg

Recombinant Rat CD99/MIC2 Protein (Fc Tag)

Sign In for Pricing
View Details
Human OR2C3 activation kit by CRISPRa
GA113040 1 Kit

Human OR2C3 activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Human KCNV2 activation kit by CRISPRa
GA116188 1 Kit

Human KCNV2 activation kit by CRISPRa

Sign In for Pricing
View Details