Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leukocyte antigen CD37 (Cd37)

This Recombinant Rat Leukocyte antigen CD37 (Cd37) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Leukocyte antigen CD37, CD_antigen= CD37

UniProt

P31053

Expression Region

1-281

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKV LSVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQ ELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANGSEELFVPCS CYNSTATNDSSGFDKLFLSQLSRLGPRAKLRQTADICALPAKAHIYREGCARSLQKWLHN NIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chebulinic Acid
TRC-C291895-2.5MG 2.5 mg

Chebulinic Acid

Sign In for Pricing
View Details
Human OC/BGP (Osteocalcin) ELISA Kit
E-EL-H1343-01 24 Tests

Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Human OC/BGP (Osteocalcin) ELISA Kit
E-EL-H1343-02 48 Tests

Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Human OC/BGP (Osteocalcin) ELISA Kit
E-EL-H1343-03 96 Tests

Human OC/BGP (Osteocalcin) ELISA Kit

Sign In for Pricing
View Details
Olodaterol Benzyl Ether
TRC-O262005-1MG 1 mg

Olodaterol Benzyl Ether

Sign In for Pricing
View Details
CD8 (C8/144B), CF488A conjugate, 0.1mg/mL
BNC880749-500 1x 500 µL

CD8 (C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details