Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P60937

Expression Region

1-282

Origin

Corynebacterium diphtheriae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQDPSSQISWSQTIVLSIVQGLTEFLPISSSGHLRIVSELFWGKDAGASFTAVVQLGTE AAVLVYFAKDIAKILTGWFRGLFDKKQRGFDYRMGWMVIVGTLPVSIVGLLAKDIIRDNL RNMWITASVLIAFSFVFIAAEKWGSKRRSFDQLTMRDAVIMGCAQCLALIPGVSRSGGTV SAGLFVGLDREVATRFSFLLAIPAVLASGLFSLPDAFAPDAGQAASGMQLAVGTGIAFAL GYASIAWLLKFVGSHSFSWFAAYRIPVGLLVMALLATGMLTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF594 conjugate, 0.1mg/mL
BNC940698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF488A conjugate, 0.1mg/mL
BNC882197-100 1x 100 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1124), CF405S conjugate, 0.1mg/mL
BNC041124-100 1x 100 µL

TOX3 (TOX3/1124), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF740 conjugate, 0.1mg/mL
BNC740485-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details