Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Putative phosphite transport system permease protein htxC (htxC)

This Recombinant Pseudomonas stutzeri Putative phosphite transport system permease protein htxC (htxC) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Putative phosphite transport system permease protein htxC

UniProt

O69062

Expression Region

1-282

Origin

Pseudomonas stutzeri (Pseudomonas perfectomarina)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQRIEEVMLANVKRDVARRKRHFATSVVVLSLLAVAWYVCQIEFQKLGAGLPRLWSFVV QMFPPDLSDLDVILKGAGETLAMATIGTIFATIIAFPLALMAARNTCPNKWTYRVSRAIL NASRGTETFVYALVFVAAVGFGPFSGVLAITFHMVGAIGKMFAEAIEPVDQGPLDALALT GASRAKIIRYGLIPDVMPHLIASVLYIWEFSVRTSTVLGIVGAGGIGQTLKDTVDLLEFN KMITVLAVVLLMVSAIDFISDRLRYLILDTKREGFETLPANN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPEB3 (NM_001178137) Human Over-expression Lysate
LC433424 20 µg

CPEB3 (NM_001178137) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse PDK4 Protein (His & GST Tag)
PKSM040290 50 µg

Recombinant Mouse PDK4 Protein (His & GST Tag)

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), 1mg/mL
BNUM0225-50 1x 50 µL

Major Vault Protein (MVP) (1032), 1mg/mL

Sign In for Pricing
View Details
Netrin 4 (NTN4) Human Gene Knockout Kit (CRISPR)
KN424596 1 Kit

Netrin 4 (NTN4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L Kynurenine Hydrolase (KYNU) Human Gene Knockout Kit (CRISPR)
KN401559 1 Kit

L Kynurenine Hydrolase (KYNU) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adipokinetic Hormone (Anax Imperator Mauricianus)
TRC-A291645-10MG 10 mg

Adipokinetic Hormone (Anax Imperator Mauricianus)

Sign In for Pricing
View Details