Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Putative phosphite transport system permease protein htxC (htxC)

This Recombinant Pseudomonas stutzeri Putative phosphite transport system permease protein htxC (htxC) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Putative phosphite transport system permease protein htxC

UniProt

O69062

Expression Region

1-282

Origin

Pseudomonas stutzeri (Pseudomonas perfectomarina)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQRIEEVMLANVKRDVARRKRHFATSVVVLSLLAVAWYVCQIEFQKLGAGLPRLWSFVV QMFPPDLSDLDVILKGAGETLAMATIGTIFATIIAFPLALMAARNTCPNKWTYRVSRAIL NASRGTETFVYALVFVAAVGFGPFSGVLAITFHMVGAIGKMFAEAIEPVDQGPLDALALT GASRAKIIRYGLIPDVMPHLIASVLYIWEFSVRTSTVLGIVGAGGIGQTLKDTVDLLEFN KMITVLAVVLLMVSAIDFISDRLRYLILDTKREGFETLPANN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Universal Fluorimetric MMP Activity Assay Kit *Green Fluorescence*
13510-AAT 100 Tests

Amplite® Universal Fluorimetric MMP Activity Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details
RbAp46 (RBBP7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A12]
TA503809BM 100 µL

RbAp46 (RBBP7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A12]

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), 1mg/mL
BNUM2035-50 1x 50 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), 1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF594 conjugate, 0.1mg/mL
BNC940373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benchtop High Speed Refrigerated Centrifuge BCBHR-210
BCBHR-210 1 Unit

Benchtop High Speed Refrigerated Centrifuge BCBHR-210

Sign In for Pricing
View Details
PDPN Rabbit Monoclonal Antibody
TA423030 100 µL

PDPN Rabbit Monoclonal Antibody

Sign In for Pricing
View Details