Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Protease HtpX (htpX)

This Recombinant Haemophilus influenzae Protease HtpX (htpX) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A5UHK2

Expression Region

1-283

Origin

Haemophilus influenzae (strain PittGG)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR LQQLHEPQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 2,2-dimethylcyclopropane-1-carboxylate
454994-01 100 mg

Methyl 2,2-dimethylcyclopropane-1-carboxylate

Sign In for Pricing
View Details
Methyl 2,2-dimethylcyclopropane-1-carboxylate
454994-02 250 mg

Methyl 2,2-dimethylcyclopropane-1-carboxylate

Sign In for Pricing
View Details
Dog Pro Atrial Natriuretic Peptide (Pro-ANP) ELISA Kit
orb782526-01 48 Tests

Dog Pro Atrial Natriuretic Peptide (Pro-ANP) ELISA Kit

Sign In for Pricing
View Details
Dog Pro Atrial Natriuretic Peptide (Pro-ANP) ELISA Kit
orb782526-02 96 Tests

Dog Pro Atrial Natriuretic Peptide (Pro-ANP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Enolase 2/Neuron-specific Enolase Antibody
NB110-58870SS 0.025 mL

Rabbit Polyclonal Enolase 2/Neuron-specific Enolase Antibody

Sign In for Pricing
View Details
Recombinant Human PSMB10/MECL1 Protein
NBP1-72454-10ug 10 µg

Recombinant Human PSMB10/MECL1 Protein

Sign In for Pricing
View Details