Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Protease HtpX (htpX)

This Recombinant Haemophilus influenzae Protease HtpX (htpX) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A5UHK2

Expression Region

1-283

Origin

Haemophilus influenzae (strain PittGG)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFAGSLISLFLSKTMALR SVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDVNAFATGATKSNSLVAV STGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFVIFLSRVIATAVASSRNN NGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRADAGSASLVGKEKMIMALQR LQQLHEPQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF587 Protein Vector (Human) (pPM-C-HA)
PV060339 500 ng

ZNF587 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
InVivoMAb Anti-Human PAUF Antibody (Iv0188)
VHD89101 100 μg

InVivoMAb Anti-Human PAUF Antibody (Iv0188)

Sign In for Pricing
View Details
DUTPase Rabbit Polyclonal Antibody (HRP)
orb479705 100 µL

DUTPase Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Matched Pair - Total RNA - Human Primary Tumor and Normal Tissue: Liver
R8235149-PP-10 2x 10 µg

Matched Pair - Total RNA - Human Primary Tumor and Normal Tissue: Liver

Sign In for Pricing
View Details
CA XIV (C-10)
sc-166305 200 µg/mL

CA XIV (C-10)

Sign In for Pricing
View Details
Recombinant Borrelia Burgdorferi OspC Protein
VAng-Lsx1736-20g 20 µg

Recombinant Borrelia Burgdorferi OspC Protein

Sign In for Pricing
View Details