Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus parasuis serovar 5 Protease HtpX (htpX)

This Recombinant Haemophilus parasuis serovar 5 Protease HtpX (htpX) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B8F543

Expression Region

1-283

Origin

Haemophilus parasuis serovar 5 (strain SH0165)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIALFLATNFAVMIVLGIILSVTGIAGNSTGGILIMSVLFGFAGSLISLFMSKTMALK SVGAEIITEPRNNAERWLVETVKRQSQQAGIPMPDVAIYHSADVNAFATGATKSNSLVAV STGLLNTMTEDEAEAVVAHEVAHIANGDMVTMTLLQGVLNTFVIFLSRMIATAVSSSRND DGEETQSSGTYFLVSMVLEILFGVLATIIAMWFSRYREFRADAGSAQLVGKEKMIAALQR LQRVHDPEELPGSLNAMMINGKAKEFFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL
BNC470800-500 1x 500 µL

Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL
BNC880028-100 1x 100 µL

CD45RA (158-4D3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF594 conjugate, 0.1mg/mL
BNC942501-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2501), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL
BNC682554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details