Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Pyrococcus horikoshii Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

O58114

Expression Region

1-283

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYELILALGWDLLLGEPPAVVHPVVWFGKLIAFIDSHYSRRSPAIDFLAGLFATLVVLSF AFLLSILPLYAPYPLNYLLSVYLLKSSFAIRSLYEHVRRTMKDDVEEMRKEVSMIVSRDT SKLGREHLISASIESLAENTNDSVVAPLFYYLLFGLPGALVYRAVNTLDAMVGYRTSRYE YFGKFSARLDDILNFLPARITVLLFLPLNPRRVIRYYKMARFKVNSDKPIAAMSAVLGIW LEKPNIYRFPGRDPRMEDIERALKVYVIVVSEWILLLLLGVIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN1 antibody
10R-11454 50 μL

ACTN1 antibody

Sign In for Pricing
View Details
AATK Antibody
orb253076 100 µL

AATK Antibody

Sign In for Pricing
View Details
IL-16 (B-2) : m-IgG Fc BP-HRP Bundle
sc-540484 1 Kit

IL-16 (B-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
TCEB1P9 Protein Vector (Human) (pPM-C-His)
PV135137 500 ng

TCEB1P9 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Interleukin-6 Receptor Subunit Beta, Il6st Primacu™ ELISA Kit
BPE297-01 96 Tests

Mouse Interleukin-6 Receptor Subunit Beta, Il6st Primacu™ ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin-6 Receptor Subunit Beta, Il6st Primacu™ ELISA Kit
BPE297-02 5x 96 Tests

Mouse Interleukin-6 Receptor Subunit Beta, Il6st Primacu™ ELISA Kit

Sign In for Pricing
View Details