Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Tetraspanin-33 (TSPAN33)

This Recombinant Bovine Tetraspanin-33 (TSPAN33) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Tetraspanin-33, Tspan-33

UniProt

Q3SYV5

Expression Region

1-283

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARRPGAPAAYGEDFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHEEAALACL AVDPAILLIVVGILMFLLTFCGCIGSLRENICLLQTFSLCLTVVFLLQLAAGVLGFVFSD KVRGKVSEIINNAIVHYRDDLDLQNLIDFGQKEFSCCGGISYKDWSLNMYFNCSEDNPSR ERCSVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDRLVNWIHSNLFVLG GVALGLAIPQLVGIMLSMILVSQIKDQIKLQLYNQQHRADPWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF740 conjugate, 0.1mg/mL
BNC741062-100 1x 100 µL

FSH beta (FSHb/1062), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL
BNC472400-100 1x 100 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL
BNC680685-500 1x 500 µL

CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details