Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449)

This Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized transporter MJ0449

UniProt

Q57891

Expression Region

1-283

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREVEKPLILSIVGNILLGLIKIIIGYVYSSISLISDGIHSLSDVITSIIGIIGVKIASK PPDESHPYGHSRFECLFSFFIGLALFFTAYEIGKFAVERIIYGEVIEVNAIMVGVAILSI VVKELMTRYSLFVGKKLNSQVLIADAYHHRSDALSSVVVLVGLLLQKFGIYYGDAIAGII VALMIAKVAFDICLTNIDYLTGRAPPKKFFELIEKEALNVDKVIGVHDIKAHYVGPRIHV ELHVEVPSNISAKEMHDIEVAVKNRLESLENVERAYVHVDIVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Prlh shRNA (UAS) - Lentiviral mouse Prlh shRNA (UAS) (25)
GTR15209969 1 Vial

Lentiviral mouse Prlh shRNA (UAS) - Lentiviral mouse Prlh shRNA (UAS) (25)

Sign In for Pricing
View Details
Tom1l2 (NM_001039092) Mouse Tagged Lenti ORF Clone
MR218753L4 10 µg

Tom1l2 (NM_001039092) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KIRREL3 (KIAA1867) discontinued
510946 100 µg

KIRREL3 (KIAA1867) discontinued

Sign In for Pricing
View Details
Phospho-GIT1 (Tyr545) Polyclonal Antibody, FITC Conjugated
bs-5373R-FITC 100 µL

Phospho-GIT1 (Tyr545) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
BSDC1 (NM_001143888) Human 3' UTR Clone
SC215136 10 µg

BSDC1 (NM_001143888) Human 3' UTR Clone

Sign In for Pricing
View Details
PRICKLE1 AAV siRNA Pooled Vector
37609161 1.0 µg

PRICKLE1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details