Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449)

This Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized transporter MJ0449

UniProt

Q57891

Expression Region

1-283

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREVEKPLILSIVGNILLGLIKIIIGYVYSSISLISDGIHSLSDVITSIIGIIGVKIASK PPDESHPYGHSRFECLFSFFIGLALFFTAYEIGKFAVERIIYGEVIEVNAIMVGVAILSI VVKELMTRYSLFVGKKLNSQVLIADAYHHRSDALSSVVVLVGLLLQKFGIYYGDAIAGII VALMIAKVAFDICLTNIDYLTGRAPPKKFFELIEKEALNVDKVIGVHDIKAHYVGPRIHV ELHVEVPSNISAKEMHDIEVAVKNRLESLENVERAYVHVDIVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAF1 Rabbit Polyclonal Antibody (Biotin)
orb453418 100 µL

RAF1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human Cord Blood CD3+ Pan T Cells
CBCD3-C20M 20 million

Human Cord Blood CD3+ Pan T Cells

Sign In for Pricing
View Details
Mouse Monoclonal TTF-1 / NKX2-1 Antibody (rNX2.1/690) [Alexa Fluor 647]
NBP3-08725AF647 100 µL

Mouse Monoclonal TTF-1 / NKX2-1 Antibody (rNX2.1/690) [Alexa Fluor 647]

Sign In for Pricing
View Details
Culture Medium for Mouse Malignant Breast Cancer Cells +Gfp [PY8119+GFP]
AFG-ELL-3646-01 125 mL

Culture Medium for Mouse Malignant Breast Cancer Cells +Gfp [PY8119+GFP]

Sign In for Pricing
View Details
Culture Medium for Mouse Malignant Breast Cancer Cells +Gfp [PY8119+GFP]
AFG-ELL-3646-02 500 mL

Culture Medium for Mouse Malignant Breast Cancer Cells +Gfp [PY8119+GFP]

Sign In for Pricing
View Details
Rabbit Monoclonal hnRNP M Antibody (S06-3B1)
NBP3-15042-25ul 25 µL

Rabbit Monoclonal hnRNP M Antibody (S06-3B1)

Sign In for Pricing
View Details