Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449)

This Recombinant Methanocaldococcus jannaschii Uncharacterized transporter MJ0449 (MJ0449) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Uncharacterized transporter MJ0449

UniProt

Q57891

Expression Region

1-283

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREVEKPLILSIVGNILLGLIKIIIGYVYSSISLISDGIHSLSDVITSIIGIIGVKIASK PPDESHPYGHSRFECLFSFFIGLALFFTAYEIGKFAVERIIYGEVIEVNAIMVGVAILSI VVKELMTRYSLFVGKKLNSQVLIADAYHHRSDALSSVVVLVGLLLQKFGIYYGDAIAGII VALMIAKVAFDICLTNIDYLTGRAPPKKFFELIEKEALNVDKVIGVHDIKAHYVGPRIHV ELHVEVPSNISAKEMHDIEVAVKNRLESLENVERAYVHVDIVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-PARP3 Antibody
dAP-1633 50 µg

Goat anti-PARP3 Antibody

Sign In for Pricing
View Details
CREB3L3 Protein Vector (Human) (pPB-C-His)
PV070777 500 ng

CREB3L3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human CNDP1 Protein Lysate
MBS139650-01 0.02 mg

Human CNDP1 Protein Lysate

Sign In for Pricing
View Details
Human CNDP1 Protein Lysate
MBS139650-02 5x 0.02 mg

Human CNDP1 Protein Lysate

Sign In for Pricing
View Details
LOC729185 Peptide - N-terminal region
orb2014681 100 µg

LOC729185 Peptide - N-terminal region

Sign In for Pricing
View Details
ChemR23 Polyclonal Antibody
orb310278-01 50 μL

ChemR23 Polyclonal Antibody

Sign In for Pricing
View Details