Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction alpha-6 protein (Gja6)

This Recombinant Mouse Gap junction alpha-6 protein (Gja6) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Gap junction alpha-6 protein, Connexin-33, Cx33

UniProt

Q6S5G4

Expression Region

1-283

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDHAFPISHVRLWVLQVIFVSVPILLYLAHAYYVVRQNKKLNKQEEELEAAHFNE ASVERHLETIAGEQFKCGSEEQSKVKMRGRLLLTYMASIFFKSVFEMAFLLIQWYIYGFT LSALYICEQSPCPRRVDCFLSRPTEKTIFILFMFVVSVVSFVLDIIELFYVLFKAIKNRM RKAEDEVYCDELPCPSHVSSSTVLTTIDSSEQAVPVELSSVCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-11997 0.1 mg

INPP1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mouse Periodontal Ligament Fibroblasts
ARP0638 0.5 Million

Mouse Periodontal Ligament Fibroblasts

Sign In for Pricing
View Details
Rabbit Polyclonal Claudin-7 Antibody [DyLight 650]
NBP3-18508C 0.1 mL

Rabbit Polyclonal Claudin-7 Antibody [DyLight 650]

Sign In for Pricing
View Details
CASP7 (N) Antibody, Rabbit Polyclonal
orb386290 100 µL

CASP7 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Steroidogenic Acute Regulatory Protein (STAR) Polyclonal Antibody
CAU37346-01 100 µL

Steroidogenic Acute Regulatory Protein (STAR) Polyclonal Antibody

Sign In for Pricing
View Details
Steroidogenic Acute Regulatory Protein (STAR) Polyclonal Antibody
CAU37346-02 200 µL

Steroidogenic Acute Regulatory Protein (STAR) Polyclonal Antibody

Sign In for Pricing
View Details