Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction alpha-6 protein (Gja6)

This Recombinant Mouse Gap junction alpha-6 protein (Gja6) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Gap junction alpha-6 protein, Connexin-33, Cx33

UniProt

Q6S5G4

Expression Region

1-283

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDHAFPISHVRLWVLQVIFVSVPILLYLAHAYYVVRQNKKLNKQEEELEAAHFNE ASVERHLETIAGEQFKCGSEEQSKVKMRGRLLLTYMASIFFKSVFEMAFLLIQWYIYGFT LSALYICEQSPCPRRVDCFLSRPTEKTIFILFMFVVSVVSFVLDIIELFYVLFKAIKNRM RKAEDEVYCDELPCPSHVSSSTVLTTIDSSEQAVPVELSSVCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Follistatin Like Protein 1 (FSTL1)
SIPJ056Hu01-01 10 µg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
SIPJ056Hu01-02 50 µg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
SIPJ056Hu01-03 200 µg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
SIPJ056Hu01-04 1 mg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
SIPJ056Hu01-05 5 mg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Rab 4/14 (F-10) Alexa Fluor® 546
sc-376243 AF546 200 µg/mL

Rab 4/14 (F-10) Alexa Fluor® 546

Sign In for Pricing
View Details